PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 279aa    MW: 31373.6 Da    PI: 5.618
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038062genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+++v ++G g W++ ar  g++Rt+k+c++rw +yl
      Lus10038062 28 KGPWTAEEDSILANYVSLHGEGYWNAAARSSGLKRTGKSCRLRWMNYL 75
                     79********************************************97 PP

2Myb_DNA-binding44.63.4e-1481124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++ +++++ ++G++ W++Ia+ ++ gRt++++k++w++
      Lus10038062  81 RGNITLQEQLVILQLHSRWGNR-WSKIAEQLP-GRTDNEIKNYWRT 124
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5132375IPR017930Myb domain
SuperFamilySSF466892.75E-2926122IPR009057Homeodomain-like
SMARTSM007177.3E-122777IPR001005SANT/Myb domain
PfamPF002492.3E-142875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-202982IPR009057Homeodomain-like
CDDcd001673.58E-93075No hitNo description
PROSITE profilePS5129422.06876130IPR017930Myb domain
SMARTSM007172.2E-1280128IPR001005SANT/Myb domain
PfamPF002497.7E-1381124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2183128IPR009057Homeodomain-like
CDDcd001673.05E-985124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDGSLENIHF MMSYDWNHSD EGRSTVKKGP WTAEEDSILA NYVSLHGEGY WNAAARSSGL  60
KRTGKSCRLR WMNYLRPNVR RGNITLQEQL VILQLHSRWG NRWSKIAEQL PGRTDNEIKN  120
YWRTRVQKLA KQLNCEVSSE QFRDAMHYDW IPRLIERIQS STTPKLPHIH QPTSSPSLYS  180
RDTNFNNSVG SASTDNSNID VVDRDNVANM SSSLEWQATS SNGASSDSFD SMTGLDFGTS  240
NYGCGGGCSN AVAVEEQSPP WEMLDDSIWL ALENDGLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2328122497MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-232812258151MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-232812258151MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-232812227120MYB TRANSFORMING PROTEIN
1mse_C2e-2328122497C-Myb DNA-Binding Domain
1msf_C2e-2328122497C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002746.14e-81PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-66MY108_ARATH; Transcription factor MYB108
TrEMBLG7ICT91e-80G7ICT9_MEDTR; MYB3
STRINGGLYMA19G40650.13e-76(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.19e-73myb domain protein 2